ICMR Tenders - View latest Indian Council Of Medical Research eTenders

ICMR Tenders - Get latest update on Indian Council Of Medical Research Tenders. Search ICMR civil Tenders, Construction Tenders, Supply Tenders, Services Tenders published on Indian Council Of Medical Research e-tendering portal & e-Procurement website are available on ICMR tender page. Many live business opportunities are available in ICMR Tenders section. Indian Council Of Medical Research Tenders are further filtered by Bid Submission Date, Tender Value, Project Location & Product Category. Get daily alert on ICMR Tenders.

1

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48820898 bids are invited for customized amc/cmc for pre-owned products - amc for non comprehensive of microscopes; leica make and carl zeiss make; annual maintenance contract (amc); six-monthly; yes total quantity :

Due Date : May 3, 2025
Tender Value : rupee 45000.0
View Notice
2

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48820623 bids are invited for customized amc/cmc for pre-owned products - amc for non comprehensive of centrifuge; eppendorf make; annual maintenance contract (amc); six-monthly; yes total quantity :

Due Date : May 3, 2025
Tender Value : rupee 70000.0
View Notice
3

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48814721 bids are invited for customized amc/cmc for pre-owned products - amc for non comprehensive of ultra centrifuge; thermoscientific make; annual maintenance contract (amc); six-monthly; yes total quantity :

Due Date : May 2, 2025
Tender Value : rupee 70000.0
View Notice
4

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48805963 bids are invited for customized amc/cmc for pre-owned products - annual maintenance contract for centrifuge avanti j30 i; beckman coulter make; annual maintenance contract (amc); six- monthly; yes total quantity :

Due Date : May 2, 2025
Tender Value : rupee 70000.0
View Notice
5

Statutory Bodies & Commissions/Committees - Tirunelveli - Tamil Nadu

48796364 bids are invited for manpower outsourcing services - minimum wage - skilled; secondary school; others total quantity :

Due Date : May 12, 2025
Tender Value : Ref. Document
View Notice
6

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48790632 bids are invited for customized amc/cmc for pre-owned products - amc for non comprehensive of freezers inclusive calibration, validation and servicing; haier medical & laboratory ltd, remi electrochnik ltd, blue star; annual maintenance contract (amc)

Due Date : May 1, 2025
Tender Value : rupee 85000.0
View Notice
7

Statutory Bodies & Commissions/Committees - Medchal Malkajgiri - Telangana

48750356 tender for single tender enquiry - supply of ferrets

Due Date : Apr 28, 2025
Tender Value : rupee 79.51 Lakhs
View Notice
8

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48730317 bids are invited for laundry service - healthcare purpose total quantity :

Due Date : May 7, 2025
Tender Value : rupee 3 Lakhs
View Notice
9

Statutory Bodies & Commissions/Committees - Chennai - Tamil Nadu

48727445 bids are invited for calibration services - fluid flow; mass and volume; nabl labs; buyer premises (onsite) total quantity :

Due Date : Apr 30, 2025
Tender Value : Ref. Document
View Notice
10

Statutory Bodies & Commissions/Committees - Bengaluru Rural - Karnataka

48717591 bids are invited for manpower outsourcing services - minimum wage - skilled; as per the sow of the tender; others , manpower outsourcing services - minimum wage - semi-skilled; as per the sow of the tender; others , manpower outsourcing services - min

Due Date : May 7, 2025
Tender Value : rupee 86.34 Lakhs
View Notice
11

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48715255 bids are invited for courier service in kg - national; pan india, west zone, central zone, south zone, north zone, east zone total quantity :

Due Date : Apr 26, 2025
Tender Value : rupee 15 Lakhs
View Notice
12

Statutory Bodies & Commissions/Committees - Chennai - Tamil Nadu

48712647 tender for 8.5 ton ductable split air conditioning system

Due Date : Apr 30, 2025
Tender Value : Ref. Document
View Notice
13

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48647454 bids are invited for manpower outsourcing services - minimum wage - unskilled; high school; admin , manpower outsourcing services - minimum wage - skilled; 12th pass; others total quantity :

Due Date : Apr 24, 2025
Tender Value : Ref. Document
View Notice
14

Statutory Bodies & Commissions/Committees - belagavi - Karnataka

48642847 tender for hiring of services to carry out body composition analysis using dexa scanning machines

Due Date : Apr 18, 2025
Tender Value : rupee 34.20 Lakhs
View Notice
15

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48636424 bids are invited for manpower outsourcing services - minimum wage - skilled; graduate; admin total quantity :

Due Date : Apr 24, 2025
Tender Value : Ref. Document
View Notice
16

Statutory Bodies & Commissions/Committees - Bengaluru Rural - Karnataka

48623632 bids are invited for manpower outsourcing services - fixed remuneration - ittechnical; as per the sow of the tender; as per the sow of the tender , manpower outsourcing services - fixed remuneration - non-it technical; as per the sow of the tender; as

Due Date : Apr 29, 2025
Tender Value : rupee 42.57 Lakhs
View Notice
17

Statutory Bodies & Commissions/Committees - hyderabad - Telangana

48617351 tender for providing shed and grill for servant quarters of directors bungalow, icmr-nin, hyderabad

Due Date : Apr 15, 2025
Tender Value : Ref. Document
View Notice
18

Statutory Bodies & Commissions/Committees - Alappuzha - Kerala

48599609 bids are invited for manpower outsourcing services - minimum wage - skilled; high school; others , manpower outsourcing services - minimum wage - highly-skilled; graduate; admin , manpower outsourcing services - minimum wage - semiskilled; high school

Due Date : Apr 28, 2025
Tender Value : Ref. Document
View Notice
19

Statutory Bodies & Commissions/Committees - Hyderabad - Telangana

48586256 bids are invited for pest and animal control service - maintenance contract; once in a month; cockroach control total quantity :

Due Date : Apr 19, 2025
Tender Value : Ref. Document
View Notice
20

Statutory Bodies & Commissions/Committees - Chennai - Tamil Nadu

48584622 tender for purchase of lexmark toners for various departments at icmr-nirt, chennai

Due Date : Apr 25, 2025
Tender Value : Ref. Document
View Notice
21

Statutory Bodies & Commissions/Committees - Khordha - Odisha

48567734 bids are invited for manpower outsourcing services - minimum wage - semiskilled; secondary school; admin total quantity :

Due Date : Apr 19, 2025
Tender Value : Ref. Document
View Notice
22

Statutory Bodies & Commissions/Committees - Kolkata - West Bengal

48567468 tender for hiring an agency for sample transport for the eqas (hep a, e) project.

Due Date : Apr 17, 2025
Tender Value : Ref. Document
View Notice
23

Statutory Bodies & Commissions/Committees - Khordha - Odisha

48567395 bids are invited for manpower outsourcing services - minimum wage - highly- skilled; high school; others total quantity :

Due Date : Apr 19, 2025
Tender Value : Ref. Document
View Notice
24

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48560551 Corrigendum : bids are invited for refilling of industrial gases in cylinders total quantity :

Due Date : Apr 21, 2025
Tender Value : rupee 80000.0
View Notice
25

Statutory Bodies & Commissions/Committees - Khordha - Odisha

48560505 bids are invited for manpower outsourcing services - minimum wage - skilled; high school; admin total quantity :

Due Date : Apr 19, 2025
Tender Value : Ref. Document
View Notice
26

Statutory Bodies & Commissions/Committees - Hyderabad - Telangana

48557117 bids are invited for pest and animal control service - maintenance contract; weekly once; rodent control total quantity :

Due Date : Apr 14, 2025
Tender Value : Ref. Document
View Notice
27

Statutory Bodies & Commissions/Committees - Hyderabad - Telangana

48552674 bids are invited for pest and animal control service - maintenance contract; twice in a month; cockroach control total quantity :

Due Date : Apr 14, 2025
Tender Value : Ref. Document
View Notice
28

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48511535 bids are invited for customized amc/cmc for pre-owned products - liquid nitrogen riffiling 40ltrs per tank; liquid nitrogen riffiling 40ltrs per tank; annual maintenance contract (amc); quarterly; no total quantity :

Due Date : Apr 12, 2025
Tender Value : Ref. Document
View Notice
29

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48511532 bids are invited for customized amc/cmc for pre-owned products - co2 gas riffiling grade 1 30kg per cylender; co2 gas riffiling grade 1 30kg per cylender; annual maintenance contract (amc); quarterly; no total quantity :

Due Date : Apr 12, 2025
Tender Value : Ref. Document
View Notice
30

Statutory Bodies & Commissions/Committees - Noida - Uttar Pradesh

48464055 tender for hcv hybridization probe for ngs library preparation

Due Date : Apr 4, 2025
Tender Value : Ref. Document
View Notice
31

Statutory Bodies & Commissions/Committees - CHENNai - Tamil Nadu

48449186 tender for annual maintenance contract (amc) for esco biosafety cabinets - 2 nos. installed and functioning at the bacteriology department, icmr-nirt, chennai.

Due Date : Apr 15, 2025
Tender Value : Ref. Document
View Notice
32

Statutory Bodies & Commissions/Committees - mumbai - Maharashtra

48447689 tender for comprehensive annual maintenance service contract (camsc) for bd facs aria iii (2011) (mol. endo. dept.)

Due Date : Apr 5, 2025
Tender Value : rupee 40 Lakhs
View Notice
33

Statutory Bodies & Commissions/Committees - Pune - Maharashtra

48411723 bids are invited for courier service in kg - national; pan india total quantity :

Due Date : Apr 15, 2025
Tender Value : rupee 25 Lakhs
View Notice
34

Statutory Bodies & Commissions/Committees - Belagavi - Karnataka

48411720 bids are invited for annual maintenance services for water purification and conditioning system (version 2) - potable water purification system ro uv uf tds control; upto 3; package-5 : water purifier and conditioning system maintenance involving basi

Due Date : Apr 4, 2025
Tender Value : Ref. Document
View Notice
35

Statutory Bodies & Commissions/Committees - Belagavi - Karnataka

48411717 bids are invited for annual maintenance services for water purification and conditioning system (version 2) - potable water purification system ro uv uf tds control; upto 3; package-4 : water purifier and conditioning system maintenance involving basi

Due Date : Apr 4, 2025
Tender Value : Ref. Document
View Notice
36

Statutory Bodies & Commissions/Committees - KOLKata - West Bengal

48376617 tender for laboratory test of mrhru project, hba1c (automated analyser by high-performance liquid chromatography (hplc) method (tosoh g8, bioscience, japan) serum creatinine by jaffe method traceable to isotope dilution mass spectrometry (idms) egfr

Due Date : Mar 28, 2025
Tender Value : Ref. Document
View Notice
37

Statutory Bodies & Commissions/Committees - Kolkata - West Bengal

48370385 bids are invited for manpower outsourcing services - minimum wage - unskilled; secondary school; others total quantity :

Due Date : Apr 5, 2025
Tender Value : rupee 1.37 Crore
View Notice
38

Statutory Bodies & Commissions/Committees - Agra - Uttar Pradesh

48361149 bids are invited for biomedical waste management service - collection; medical colleges & institutions total quantity :

Due Date : Apr 5, 2025
Tender Value : rupee 6 Lakhs
View Notice
39

Statutory Bodies & Commissions/Committees - belagavi - Karnataka

48358561 tender for hiring of services to carry out body composition analysis using dexa scanning machines

Due Date : Mar 31, 2025
Tender Value : rupee 34.20 Lakhs
View Notice
40

Statutory Bodies & Commissions/Committees - Bhopal - Madhya Pradesh

48351517 bids are invited for nucleic acid sequencing and genotyping service - meta genome; stool; human / animal tissue; to be collected by the service provider from the buyer; pac bio; 95% and above; 50x; high throughput; secondary analysis; physical media,

Due Date : Apr 10, 2025
Tender Value : Ref. Document
View Notice
41

Statutory Bodies & Commissions/Committees - Patna - Bihar

48342599 bids are invited for monthly basis cab & taxi hiring services - suv; 2500 km x 320 hours; outstation total quantity :

Due Date : Mar 31, 2025
Tender Value : Ref. Document
View Notice
42

Statutory Bodies & Commissions/Committees - Kolkata - West Bengal

48341674 bids are invited for manpower outsourcing services - fixed remuneration - healthcare; project research scientist; as per attached tender document , manpower outsourcing services - fixed remuneration - healthcare; project technical support; as per atta

Due Date : Mar 31, 2025
Tender Value : rupee 71.58 Lakhs
View Notice
43

Statutory Bodies & Commissions/Committees - Kolkata - West Bengal

48341126 bids are invited for manpower outsourcing services - minimum wage - skilled; graduate; admin , manpower outsourcing services - minimum wage - skilled; secondary school; others , manpower outsourcing services - minimum wage - semiskilled; secondary sch

Due Date : Apr 4, 2025
Tender Value : rupee 57.81 Lakhs
View Notice
44

Statutory Bodies & Commissions/Committees - hyderabad - Telangana

48329179 tender for renovation of room no.214 gopalan block hyderabad

Due Date : Mar 26, 2025
Tender Value : Ref. Document
View Notice
45

Statutory Bodies & Commissions/Committees - belagavi - Karnataka

48311742 tender for limited tender enquiry for engagement of dgr empaneled security agency for providing security services on contractual basis

Due Date : Apr 8, 2025
Tender Value : rupee 81 Lakhs
View Notice
46

Statutory Bodies & Commissions/Committees - Maharashtra

48308955 tender for antimicrobial peptide ecamp1 - gsgrgscrsqcmrrhedepwrvqecvsqcrrrrgggd 5mg 95%min 2. flower sp.gamma-thionin -rtcqsqshrfrgpclrrsncanvcrtegfpggrcrgfrr rcfctthc5mg 95%min 3. antimicrobial peptidela-aqrcgdqargakcpnclccgkygfcgsgdaycgagscq sqcrgc

Due Date : Mar 28, 2025
Tender Value : Ref. Document
View Notice
47

Statutory Bodies & Commissions/Committees - Bengaluru Rural - Karnataka

48299825 bids are invited for manpower outsourcing services - minimum wage - unskilled; as per the sow of the tender; admin , manpower outsourcing services - minimum wage - semi-skilled; as per the sow of the tender; admin , manpower outsourcing services - min

Due Date : Apr 7, 2025
Tender Value : rupee 64.08 Lakhs
View Notice
48

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48292731 bids are invited for advertisement service - newspaper - display type advertisement; any inside page of main page; times of india loksatta navbharat times; english hindi marathi; all india maharashtra; black and white; davp rates total quantity :

Due Date : Mar 20, 2025
Tender Value : Ref. Document
View Notice
49

Statutory Bodies & Commissions/Committees - Mumbai - Maharashtra

48292525 bids are invited for advertisement service - newspaper - display type advertisement; any inside page of main page; employment news; hindi english; all india; black and white; davp rates total quantity :

Due Date : Mar 20, 2025
Tender Value : Ref. Document
View Notice
50

Statutory Bodies & Commissions/Committees - Chennai - Tamil Nadu

48282050 tender for internal auditing of expenditures incurred during the financial year 2024-25

Due Date : Apr 2, 2025
Tender Value : Ref. Document
View Notice
Tell us about your Product / Services,
We will Find Tenders for you
Top
Cnet Technologies

We are a group of professionals specializing in custom software development, web development, mobile app development, IOT base solutions, web design, graphics & Enterprise solutions provid.

About Us

Services

Browse Tenders

For Sales Inquiry

Connect With Us

Copyright © 2025 · All Rights Reserved. Terms of Usage | Privacy Policy

For Tender Information Services Visit : TenderDetail