2855 Flower tenders in Maharashtra 2025

Get latest Flower related Tenders, online published by Bank Of Maharashtra, Cidco Maharashtra Ltd., City and Industrial Development Corporation of Maharashtra from Maharashtra state. Participate online through e-Procurement website for Flower tenders in Maharashtra. Download Tender Documents, BOQ, Technical Bids for Flower related Tenders from Maharashtra. Get Bidding support for etenders related to Flower Tenders in Maharashtra. Get updated with latest information & right bids related to your product & Services, We also scan local newspapers, Government websites, e-Procurement portal for Flower tenders published from Maharashtra. Also get daily email alerts for Flower related tender notices published by Government of Maharashtra.

Search Result

Boards / Undertakings / PSU - Maharashtra

48856203 bids are invited for custom bid for services priest/pujari services , custom bid for services hiring of facility attendant , custom bid for services maintenance of gym equipments , custom bid for services hiring of pump operator , custom bid f

Due Date : May 5, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - nashik - Maharashtra

48852276 tender for supply of flowers/plants of various colors, red soil, pot etc. in front of the university academic hall kashmiri rose areca palm kuber curtain creeper mogra ningandha tappuchaina maiphagia pend mans pentans coleus acaly

Due Date : Apr 29, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mumbai - Maharashtra

48838055 tender for concreting and laying flower plants at sayunkt building, wadala sewri cross road, wadala.

Due Date : Apr 30, 2025

Tender Value :

20.56 Lakhs

View Notice

Local Bodies - Mumbai - Maharashtra

48837689 tender for concreting and laying flower plants ar sayunkt building wadala sewri cross road, wadala .

Due Date : Apr 30, 2025

Tender Value :

20.56 Lakhs

View Notice

Private Organizations - Raigad - Maharashtra

48836247 auction sale of immovable property

Due Date : May 30, 2025

Tender Value :

93.15 Lakhs

View Notice

Trust & NGO - mumbai - Maharashtra

48826353 tender for purchase of garland flowers for sri siddhivinayak ganapati

Due Date : Apr 28, 2025

Tender Value : Ref. Document

View Notice

Trust & NGO - Mumbai - Maharashtra

48821663 tender for erection of temporary pandal, lights, electrical fittings and other arrangements(including comprehensive maintenance and dismantling)for festival coming in 1st june 2025 to 31st may 2026

Due Date : May 8, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

48793897 bids are invited for procurement of wreath and flowers for wreath laying ceremony at war memorial , artificial flowers and leaf decoration handicraft total quantity : 5

Due Date : May 12, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

48727939 bids are invited for repair and overhauling service fabrication of iron flower stand 11 feet in to 4 feet with plastic pot 200 and plants 200; fabrication of iron flower stand 11 feet in to 4 feet with plastic pot 200 and plants 200; no; buyer premis

Due Date : Apr 18, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - mumbai - Maharashtra

48708762 up gradation of science labs in primary and secondary schools of bmc education department

Due Date : May 6, 2025

Tender Value : Ref. Document

View Notice

Trust & NGO - mumbai - Maharashtra

48699870 tender for buy garland flowers for sri siddhivinayak ganapati temple

Due Date : Apr 21, 2025

Tender Value : Ref. Document

View Notice

Cooperative - mumbai - Maharashtra

48692240 tender for appoint for the financial year 2025 26 for supply of goods/work as per below sample details. uniform shoes uniform dress male (officer, constable, security guard) sfemale (sari) stationery, printing, flex printing, xerox paper, computer

Due Date : Apr 25, 2025

Tender Value : Ref. Document

View Notice

Government Departments - dhule - Maharashtra

48673989 tender for supplying and providing swarg rath for grampanchayat deur bk at village mauje deur bktal and dist dhule swarg rath specification:1. 4 wheeler trailer2. trailer mounted rath3. size 10 x 6 feet4. material stainless steel, aluminium, mild steel5

Due Date : Apr 18, 2025

Tender Value : Ref. Document

View Notice

Government Departments - raver - Maharashtra

48673321 tender for e quotation for preparation of estimate of beautification of shri.chhatrapati shivaji maharaj chauk at raver, tal.raver, dist.jalgaon , providing and fixing grey stone finish grc meghdambari for existing statue of chatrapati shivaji maharaj of

Due Date : Apr 17, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

48672445 bids are invited for custom bid for services unskilled man power for house keeping services as per scope and boq and bidder to quote lumpsum price for 2 unskilled for 24 months including gst to be quoted in gem , custom bid for services semiskille

Due Date : May 2, 2025

Tender Value : Ref. Document

View Notice

Government Departments - mumbai - Maharashtra

48648212 tender for jrh kitchen veg. supply contract for one year

Due Date : May 2, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - MUMBAI - Maharashtra

48643652 supply of housekeeping items, supply of stationary misc items for erp centre vashi

Due Date : Apr 23, 2025

Tender Value : Ref. Document

View Notice

Government Departments - pune - Maharashtra

48625584 Corrigendum : tender for supply of grocery items for the year 2025 (06 months duration) for krida prabodhini pune dining hall grocery details 2 suhana chole masala (200 gm) 3 everest chole masala (200 gm) 4 suhana chicken masala (200 gm) 5 everest chicken masala (200

Due Date : Apr 29, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - Mumbai - Maharashtra

48604430 tender for supply of items perishable products: (chapati cooked fresh, cheese (ind & imp), chicken/poultry, chinese & mexican food, eggs, fresh flowers & plants, mushroom, frozen peas, corn & frozen snacks, fruits & vegetables (indian & imported), banan

Due Date : Apr 17, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - nashik - Maharashtra

48589384 tender for price lists for supply of flowers/plants of various colors, red soil, pot etc. in front of university academic room १) kashmiri rose areca palm kuber cürtain creeper mogra nisigandha ७ tappuchaina 4) malphagia ) pend

Due Date : Apr 15, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - MUMBAi - Maharashtra

48588904 tender for various items

Due Date : Apr 15, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Tuljapur - Maharashtra

48586328 tender for the work to be done in the year 2025 26 through the city council office, the work to be done for the garlands, flowers, bouquets, bunches, flower decorations, photos, puja materials, shawls, feta and etc.

Due Date : Apr 11, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - amalner - Maharashtra

48582120 tender for supply essentials item for amalner municipal council for annual year 2025 2026

Due Date : Apr 10, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Palghar - Maharashtra

48581981 training and development flower making and jewellery making, for grampanchayat chandrapada tal vasai dist palghar

Due Date : Apr 12, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - darwha - Maharashtra

48571972 tender for invitation of annual tender for financial year 2025 2026 of supplying of spare parts instruments and other relevant items for repairing and maintenance of handpump availbale in various areas for municipal council darwha

Due Date : Apr 11, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mumbai - Maharashtra

48568975 tender for providing flower decoration and garlands at junction of madam cama road k b patil marg in a ward for dr babasaheb ambedkar birth anniversary

Due Date : Apr 9, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - vasai - Maharashtra

48554250 tender for required quotation for flower broom , snoring broom dettol formula mop signature rod washing brush foot rub duster (table duster) duster (ladi duster) sup to pick up garbage toilet cleaning brush

Due Date : Apr 9, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - vasai - Maharashtra

48554228 tender for rate for following materials flower broom snoring broom dettol soap mop signature rod a brush of clothing foot rub duster (table duster) duster (ladi duster) sup to pick up garbage toilet cleaning brush platic badli, acid,

Due Date : Apr 9, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - bhandara - Maharashtra

48551641 tender for decoration for various programs/festival in bhandara municipal council

Due Date : Apr 17, 2025

Tender Value : Ref. Document

View Notice

Government Departments - jalgaon - Maharashtra

48540698 tender for jalgaon indl.area maintenance and repair to non residential building renovation of parking shed and flower beds area at cfc building 2nd call

Due Date : Apr 10, 2025

Tender Value :

13.79 Lakhs

View Notice

Government Departments - nashik - Maharashtra

48534895 tender for supply of various type of garden equipments for garden and tree authority department, nmc. (re tender)

Due Date : Apr 15, 2025

Tender Value :

13.16 Lakhs

View Notice

Local Bodies - bhiwandi - Maharashtra

48521963 tender for regarding the purchase of computer equipment for various departments of bhiwandi nizampur city municipal corporation

Due Date : Apr 7, 2025

Tender Value :

24 Lakhs

View Notice

Local Bodies - airoli - Maharashtra

48513100 tender for regarding supply of tea and snacks and mandap decoration on14 april and 6 december at dr. babasaheb ambedkar smarak airoli

Due Date : Apr 7, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - ghatkopar - Maharashtra

48510500 tender for construction of flower beds and beautification of wall at wdip office nitynand nagar ghatkopar w in n ward

Due Date : Apr 7, 2025

Tender Value : Ref. Document

View Notice

Trust & NGO - mumbai - Maharashtra

48502060 tender for procurement of garland flowers for temple.

Due Date : Apr 11, 2025

Tender Value : Ref. Document

View Notice

Government Departments - dhule - Maharashtra

48500819 providing table ,chairs and toys for anganwadiatvillage mauje nertal and dist dhuleforunder 15th finance commission grampanchayat level

Due Date : Apr 4, 2025

Tender Value : Ref. Document

View Notice

Government Departments - mehkar - Maharashtra

48484808 Corrigendum : providing and supplying various materials at sukali tq mehkar dist buldana , providing and supplying various material (ganwesh, hande, chappal stand , note book, pensil, rangkadya , cooker, kothi, chart,kapat (mothe) satranji(mothi), patti, patele ,table

Due Date : Apr 4, 2025

Tender Value : Ref. Document

View Notice

Government Departments - deori - Maharashtra

48483023 proposed poha processing shed for processing of moha flowers 73.183 sqmt

Due Date : Apr 11, 2025

Tender Value :

13.50 Lakhs

View Notice

Government Departments - indapur - Maharashtra

48481434 tender for redevelopment and promotion of shri malojiraje bhosale garhi and hazrat chandshahwali baba dargah at mauje indapur taluka indapur. ta. indapur, district pune. regarding getting the rates approved for external items as per the state list. (onlin

Due Date : Apr 8, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Chalisgaon - Maharashtra

48480805 tender for chalisgaon n.p. supply of computer equipment for the office for the financial year 2025 26 chalisgaon n.p. supply of banners and related materials for the financial year 2025 26. chalisgaon n.p. for the office throughout the year, for v

Due Date : Apr 4, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Nagpur - Maharashtra

48467226 tender for plantation of trees on main road divider at nagar panchayat besa pipla

Due Date : Apr 4, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Nagpur - Maharashtra

48467169 tender for plantation of trees on main road divider at nagar panchayat besa pipla

Due Date : Apr 4, 2025

Tender Value : Ref. Document

View Notice

Government Departments - nanded - Maharashtra

48452006 tender for restoration ,conservation and development work at nandgiri fort , ta.and dist nanded

Due Date : Apr 2, 2025

Tender Value :

6.05 Crore

View Notice

Trust & NGO - Mumbai - Maharashtra

48451564 Corrigendum : tender for tender for supply of flowers

Due Date : Apr 28, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Nagpur - Maharashtra

48430330 tender for decoration work, furniture, electrical, and flower décor for the 9 th convocation of iim nagpur.

Due Date : Apr 15, 2025

Tender Value : Ref. Document

View Notice

Statutory Bodies & Commissions/Committees - Pune - Maharashtra

48415302 bids are invited for flower pot made of clay small size, flower pot made of plastic,carpet 12 x 7 feet,brass chain set wi total quantity : 267

Due Date : Mar 27, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - darwha - Maharashtra

48396650 tender for invitation of annual tender for financial year 2025 2026 of supplying of spare parts instruments and other relevant items for repairing and maintenance of handpump availbale in various areas for municipal council darwha

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Pune - Maharashtra

48380155 annual tender for purchase of hardware material for store department

Due Date : Apr 2, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - sangamner - Maharashtra

48342025 tender for painting work with material and labor as required within the sangamner municipal council limits for the financial year 2025 26 applying oil paint color to the walls, iron doors, windows, grills, rolling shutters etc. 2 applying oil paint colo

Due Date : Mar 25, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - mumbai - Maharashtra

48332918 tender for n. pt. providing hired vehicle for office work. (four wheels) n. pt. supply and maintenance of furniture materials, cupboards, tables, chairs and ancillary materials for n. pt. providing rickshaw vehicle with battery, speaker for office wor

Due Date : Mar 27, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - Mumbai - Maharashtra

48331870 tender for supply of items 1) dry fruits, dry groceries, pulses and spices 2) spices [mdh/everest / badsha] 3) indian/imported fruits 4) local vegetables 5) spice whole/powder 6) onion/potato 9) cold press juice 7) juice tettra pack 8) papad impor

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - Mumbai - Maharashtra

48321114 auction sale of property all that part and parcel of residential flat no.402 having carpet area of 556 sq. feet and built up area of 667 sq. feet and area of flower bed, elevation treatment, passages and all such area of 384 sq. feet with a total 9

Due Date : Apr 2, 2025

Tender Value : Ref. Document

View Notice

Statutory Bodies & Commissions/Committees - Maharashtra

48308955 tender for antimicrobial peptide ecamp1 gsgrgscrsqcmrrhedepwrvqecvsqcrrrrgggd 5mg 95%min 2. flower sp.gamma thionin rtcqsqshrfrgpclrrsncanvcrtegfpggrcrgfrr rcfctthc5mg 95%min 3. antimicrobial peptidela aqrcgdqargakcpnclccgkygfcgsgdaycgagscq sqcrgc

Due Date : Mar 28, 2025

Tender Value : Ref. Document

View Notice

Trust & NGO - mumbai - Maharashtra

48291521 tender for the supply contract of coconut, mined, todhani, chunri, cotton pieces etc. to take and garland flowers etc

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - Mumbai Suburban - Maharashtra

48288155 Corrigendum : bids are invited for fresh cut floral bouquet service flower pot for dias large; carnation, rose all colours, gladers, zerber and seasonal flowers; 15 flowers , fresh cut floral bouquet service flower pot officers room big; carnation, rose all colo

Due Date : May 2, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mumbai Suburban - Maharashtra

48273126 tender for providing /fixing ladikaran in chawl beside little flower school amrut nagar

Due Date : Mar 20, 2025

Tender Value :

12.64 Lakhs

View Notice

Local Bodies - yavatmal - Maharashtra

48225685 tender for regarding the request for rates on rental basis for the related items required for the year 2025 26 for arranging complete bedding arrangements sound system and decoration of the tent for various programs to be held under each department a

Due Date : Mar 19, 2025

Tender Value : Ref. Document

View Notice

Cooperative - mumbai - Maharashtra

48225625 tender for the redevelopment project of wild flower hall, co operative housing society limited

Due Date : Mar 27, 2025

Tender Value : Ref. Document

View Notice

Cooperative - Maharashtra

48202863 tender for replacement of granite, marble, and tiles flower valley co op housing society ltd.

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - chalisgaon - Maharashtra

48186738 tender for providing electrical material ,erecting electrical work and repairing of electrical equipment of municipal council chalisgaon for fy 2025 26

Due Date : Mar 17, 2025

Tender Value :

3.60 Lakhs

View Notice

Local Bodies - kolhapur - Maharashtra

48173330 tender for construction of protection wall on the road side from sushant vibhute house to mahesh khatavkar house in ward no. 7 in malkapur municipal council limits. construction of half round gutter on the road side from prakash shitturkar house to chan

Due Date : Mar 17, 2025

Tender Value :

3.47 Lakhs

View Notice

Private Organizations - Thane - Maharashtra

48170808 auction sale of property all the piece and parcel of flat no. 304, on the 3rd flr, bldg no 9, type c1 (ca), inteh building known as “samruddhi evergreen”, near prime water comapny,kalyan karjat rd, badlapur east – 421503.admeasuring: 543 sq. ft

Due Date : Mar 24, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - Mumbai - Maharashtra

48170807 auction sale of property all the piece and parcel of flat no 706, 7th floor,happy home c wing,drakshi bagh j.m road, bhandup west,mumbai,400,078area admeasuring : 409 sq. ft. carpet area + 57 sq. ft. balcony 148 sq ft flower bed area (total 608

Due Date : Mar 24, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Nagpur - Maharashtra

48105154 tender for municipal council mohpa swachha sarvekshan 2025 2026 supply of goods (third call)

Due Date : Mar 12, 2025

Tender Value : Ref. Document

View Notice

Government Departments - jalgaon - Maharashtra

48104750 tender for additional jalgaon industrial area... maintenance and repair to non residential building…. renovation of parking shed and flower beds area at cfc building.

Due Date : Mar 17, 2025

Tender Value :

13.79 Lakhs

View Notice

Local Bodies - thane - Maharashtra

48102954 Corrigendum : tender for to provide flower bouke,tulsi rope, haar, flower decoration, flowers etc. for various programs which held by thane municipal corporation, thane

Due Date : Apr 15, 2025

Tender Value : Ref. Document

View Notice

Government Departments - jalna - Maharashtra

48102203 tender for mandap and other all essential services and its complete management for krushi mahostav jalna.

Due Date : Mar 10, 2025

Tender Value :

20 Lakhs

View Notice

Private Organizations - Thane - Maharashtra

48089373 auction sale of property flat no.201, admeasuring on or about 988 sq. ft., carpet area on the 2nd floor in the building no. a3 12, of “ flower valley complex co. op. hsg. soc. ltd.” in the housing complex known as “ flower valley” that is resting on

Due Date : Mar 17, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Kolhapur - Maharashtra

48080581 bids are invited for smart solar desk , smart flower solar total quantity : 1

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - Pune - Maharashtra

48075539 Corrigendum : bids are invited for custom bid for services priestpujari services , custom bid for services hiring of facility attendant , custom bid for services maintenance of gym equipments , custom bid for services hiring of pump operator , custom bid fo

Due Date : Mar 31, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Indapur - Maharashtra

48071701 tender for providing necessary stationery materials to indapur municipal council, xeroxing of official and necessary documents of indapur municipal council, printing of indapur municipal council office documents, registers and other necessary document

Due Date : Mar 11, 2025

Tender Value : Ref. Document

View Notice

Boards / Undertakings / PSU - Mumbai Suburban - Maharashtra

48068065 bids are invited for fresh cut floral bouquet service regular flower arrangement; as per the scope of work attached; as per the scope of work attached total quantity :

Due Date : Mar 25, 2025

Tender Value :

12 Lakhs

View Notice

Government Departments - Pune - Maharashtra

48054302 Corrigendum : survey, design, fabrication, supply, installation, testing, commissioning of on grid solar rooftop project with net meter and remote monitoring system, capacity of 40 kw at high technology flower and vegetables production center, agriculture university, s

Due Date : Mar 10, 2025

Tender Value :

20.88 Lakhs

View Notice

Government Departments - sangli - Maharashtra

48031749 tender for providing facilities to open space in surrounding areas of new administrative building in jath, tal jath dist sangli.(paving block, flower bed, fencing, waiting area etc

Due Date : Mar 8, 2025

Tender Value :

47.14 Lakhs

View Notice

Government Departments - Miraj - Maharashtra

48023838 providing facilities to open space in surrounding areas of new administrative building in jath tal jath dist sangli.paving block flower bed fencing waiting area etc)

Due Date : Mar 8, 2025

Tender Value :

47.14 Lakhs

View Notice

Statutory Bodies & Commissions/Committees - Pune - Maharashtra

48015969 bids are invited for beautification of battalion flower pot made of clay small size , flower pot made of plastic , carpet 12 x 7 feet , brass chain set with brass base and weight plate with complete accessories , weight plate for t flags flower pot m

Due Date : Mar 22, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

47999168 supply of (a) maintenance and development of ne section station garden from shahad to igatpuri, vasai to diva, and east section diva to roha section for a period of two years (24 months) by watering, trimming, cutting and pruning of plants lawn etc,

Due Date : Apr 1, 2025

Tender Value :

3.43 Crore

View Notice

Statutory Bodies & Commissions/Committees - Pune - Maharashtra

47990394 bids are invited for proc of flower pots mse flower pot made of clay small size , flower pot made of plastic , carpet 12 x7 feet , brass chain set with brass base and weight plate with complete accessories , weight plate for t flags flower pot made o

Due Date : Mar 21, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - pune - Maharashtra

47974817 tender for supply of fresh fruits, vegetables (imported/local), milk & dairy products, meet & meat products, sea foods, cheese, egg, fish, frozen green peas, corn, whipping cream, butter & cold cuts, local/imported grocery, bakery products, juices, puls

Due Date : Mar 10, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Palghar - Maharashtra

47973467 tender for price quotations for the work of providing rose flower and plant as follows rose plant with flower (per kg with polythene bag)

Due Date : Mar 3, 2025

Tender Value : Ref. Document

View Notice

Government Departments - jamner - Maharashtra

47961701 Corrigendum : tender for providing various facilities at waghur dam backwater (old shingayet shivar) tal.jamner dist. jalgaon. (tent, flower decoration, chairs, furniture etc.)

Due Date : Mar 4, 2025

Tender Value :

1.67 Crore

View Notice

Local Bodies - amalner - Maharashtra

47932188 tender for supply essentials item for amalner municipal council for annual year 2025 2026

Due Date : Mar 3, 2025

Tender Value : Ref. Document

View Notice

Government Departments - nagpur - Maharashtra

47931255 tender for tender for supply of office stationery materials

Due Date : Mar 10, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Kolhapur - Maharashtra

47919736 Corrigendum : bids are invited for soybean oil , kirti gold sarki oil , sonai soyabin oil , sun flower oil , kirti gold sun flower oil , sunny sun flower oil , gemmini sun flower oil , dalada , star jeera rice , my choice rice , ratnagiri 24 , lal gulab hmt steam rice ,

Due Date : Mar 26, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Kannad - Maharashtra

47912010 auction sale of the weekly market land rent fee, animal certificate, goat butchery fee, fruits and flowers, goat mutton sellers, chicken mutton sellers and fish sellers etc.

Due Date : Mar 3, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mumbai Suburban - Maharashtra

47911766 repairs of seating arrangement and flower bed granite at veer abdul hamid garden kandivali east

Due Date : Feb 27, 2025

Tender Value :

10.12 Lakhs

View Notice

Government Departments - tiwari - Maharashtra

47869633 tender for training and development aari work,shivankam,navvari shivane,fulache dagine making,for grampanchayat tiwari tal vasai dist palghar

Due Date : Feb 27, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

47847076 extension of time e tender for annual maintenance contract for horticulture works including flower arrangement/landscape and gardening at central office building, reserve bank of india, fort, mumbai

Due Date : Feb 25, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Pune - Maharashtra

47830278 tender for providing temporary lighting, cctv and p.a.system arrangement for fruit, flowers, vegetabales exhibition and other different programs as per requirement other area under a zone for year 2024 25

Due Date : Mar 4, 2025

Tender Value :

21.18 Lakhs

View Notice

Government Departments - mumbai - Maharashtra

47808412 tender for crockery full set :crockery full set

Due Date : Feb 20, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Satara - Maharashtra

47807318 tender for preservation, conservation and restoration of natural five elements under “mazi vasundhara abhiyan” of karad municipal council, karad –maintenance of old and new green area

Due Date : Feb 24, 2025

Tender Value :

55.08 Lakhs

View Notice

Private Organizations - Thane - Maharashtra

47759782 tender for supply of

Due Date : Feb 28, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mumbai Suburban - Maharashtra

47744617 supply of plant and lawn for 28th mumbai flower show (2024 25) at nursery ghatkopar in n ward

Due Date : Feb 18, 2025

Tender Value : Ref. Document

View Notice

Private Organizations - PUNE - Maharashtra

47743091 tender for supply of items

Due Date : Feb 28, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Nagpur - Maharashtra

47742278 tender for municipal council mohpa swachha sarvekshan 2025 2026 supply of goods

Due Date : Feb 20, 2025

Tender Value : Ref. Document

View Notice

Government Departments - mumbai - Maharashtra

47739586 tender for crockery full set :crockery full set

Due Date : Feb 17, 2025

Tender Value : Ref. Document

View Notice

Government Departments - Mumbai - Maharashtra

47728471 supply of zone horticulture: ccg vr sec development of gardens of supply of fertilizers, manure seeds, plants, flower pots, garden equipment and accessories.zone horticulture: ccg vr sec development of gardens of supply of fertilizers, manure see

Due Date : Mar 7, 2025

Tender Value :

30.97 Lakhs

View Notice

Government Departments - mumbai - Maharashtra

47721859 tender for crockery full set: crockery full set

Due Date : Feb 17, 2025

Tender Value : Ref. Document

View Notice

Local Bodies - Mahabaleshwar - Maharashtra

47712879 tender for the office list, supply of materials such as small and tall seedlings of trees, small and tall plants of ornamental flower trees, taiwan lawn, samriddhi brown fiber pots, manure and vermicompost for a period of two years

Due Date : Feb 21, 2025

Tender Value : Ref. Document

View Notice

100

Government Departments - mumbai - Maharashtra

47695076 tender for supply of crockery for mantralaya, square meal, vidhan bhavan canteen mumbai and konkan bhavan canteen navi mumbai.

Due Date : Feb 20, 2025

Tender Value :

14.24 Lakhs

View Notice

Tenders By City

Top